PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DL_6DA0DFC5B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 157aa    MW: 17841.5 Da    PI: 10.493
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DL_6DA0DFC5B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.61.8e-29959151
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           krien++ rqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fs +g+lyey+s
  Traes_1DL_6DA0DFC5B.1  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSARGRLYEYAS 59
                           79***********************************************86 PP

2K-box89.18.1e-3083156982
                  K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqk 82 
                             + + +++ qqe+akL+ +i++Lq+ +R+l+Ge++++L+lkeL++Le++L+k++ +iR+kK+ell+++ie++qk
  Traes_1DL_6DA0DFC5B.1  83 IDVNSQQYFQQESAKLRHQIQSLQNANRNLMGESVGNLTLKELKSLENRLDKGIGRIRAKKHELLFAEIEYMQK 156
                            5667789******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.179161IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.29E-32273IPR002100Transcription factor, MADS-box
CDDcd002657.11E-42271No hitNo description
PRINTSPR004047.8E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-323859IPR002100Transcription factor, MADS-box
PfamPF014861.0E-2285156IPR002487Transcription factor, K-box
PROSITE profilePS5129712.23888157IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCE AEIALIVFSA RGRLYEYASN  60
STRTTIDRYK KASASASGSA PAIDVNSQQY FQQESAKLRH QIQSLQNANR NLMGESVGNL  120
TLKELKSLEN RLDKGIGRIR AKKHELLFAE IEYMQKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-20173173Myocyte-specific enhancer factor 2B
1tqe_Q1e-20173173Myocyte-specific enhancer factor 2B
1tqe_R1e-20173173Myocyte-specific enhancer factor 2B
1tqe_S1e-20173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM5028950.0AM502895.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM27B (WM27B gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266821.11e-101uncharacterized protein LOC100832541
RefseqXP_010230319.11e-101PREDICTED: uncharacterized protein LOC100832541 isoform X1
SwissprotQ8RU311e-95MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLW4ZPM01e-112W4ZPM0_WHEAT; Uncharacterized protein
TrEMBLW5AFS01e-112W5AFS0_WHEAT; Uncharacterized protein
STRINGBRADI2G25090.11e-101(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.11e-75MIKC_MADS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]